- Product Details
Keywords
- PHM-27/PHI, human
- HADGVFTSDFSKLLGQLSAKKYLESLM-NH2
- H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2
Quick Details
- ProName: PHM-27 (HUMAN)
- CasNo: 87403-73-4
- Molecular Formula: C135H214N34O40S
- Appearance: White lyophilised solid
- Application: Cardiovascular System & Diseases
- DeliveryTime: inquire
- PackAge: mg/g/kg
- Port: shanghai
- ProductionCapacity: inquire /
- Purity: >98%
- Storage: -20°C, avoid light, cool and dry place
- Transportation: DHL/Fedex
- LimitNum: 5 Milligram
Superiority
PHM-27 (human) also called PHM-27/PHI, human, is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.
Our peptide has key advantages. It enables precise sequence design for specific needs, offers high purity via advanced methods, and provides flexibility in length, modification, and quantity, crucial for diverse applications.
Details
Shanghai Yaxian Chemical Co.,Ltd stands as a highly renowned, technology - driven enterprise with a strong focus on synthetic custom peptides, custom antibodies, and active pharmaceutical ingredients (APIs).
Situated in Jiangsu, our establishment encompasses a 1000 - square - meter plant and office area. Within this space, we house a total of 3 workshops. These workshops are equipped with 2 chemical synthesis lines, which are crucial for the production of a wide range of chemical compounds. Additionally, we have 2 peptide synthesis lines dedicated to the precise creation of custom peptides. Our 1 R&D center serves as the epicenter of innovation, where our team of experts constantly explores new techniques and methodologies.
Our team of professionals boasts over 20 years of in - depth experience in peptide research. This wealth of knowledge, combined with our state - of - the - art peptide synthesis equipment and cutting - edge technology, allows us to offer highly reliable products and services to our global clientele. We are committed to maintaining the highest standards of quality at every stage of production, from raw material procurement to the final delivery of products.
Today, our products and services have reached clients in more than 50 countries and regions across the globe. We have built a solid reputation for our prompt delivery, excellent product quality, and outstanding customer service.
Yaxian is unwaveringly committed to becoming the world's most reliable chemical company. We strive to provide a comprehensive one - stop solution for biochemistry research, covering everything from the synthesis of complex molecules to providing technical support and guidance to our clients. Whether it's a small - scale research project or a large - scale industrial production requirement, Yaxian is the partner you can trust for all your chemical and biochemical needs.